PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma3g01250.1
Common NameZOSMA_3G01250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MYB_related
Protein Properties Length: 1233aa    MW: 137335 Da    PI: 6.7502
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma3g01250.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.9e-07927969347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT  E   +vda++++G++ +  I++++  +R+ +qck ++ k 
   Zosma3g01250.1 927 DWTDTEKSMFVDAFRLFGMD-FIQISHYLE-TRSKEQCKIFFSKT 969
                      6*******************.*********.********888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.47E-12711768IPR009057Homeodomain-like
PROSITE profilePS5129314.067718769IPR017884SANT domain
SMARTSM007172.0E-6719767IPR001005SANT/Myb domain
PROSITE profilePS5129313.404923974IPR017884SANT domain
SMARTSM007174.0E-4924972IPR001005SANT/Myb domain
PfamPF002492.1E-5927967IPR001005SANT/Myb domain
SuperFamilySSF466895.38E-9927974IPR009057Homeodomain-like
CDDcd001671.70E-4928966No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1233 aa     Download sequence    Send to blast
MPAEPNPFNR RDFVYRGERR PHERDLTDGF VGVGGGSLSS SPTPWQLDPN HSPSPRRHFS  60
GYYKQVFADE PGINGHNINR SKVEGCRNSY GRYSRPANLR ETHDYSRRSS WNYDDLPRRQ  120
HDPVTTNAQR QVVIPYASPT SPSSSSSYQP QVQLSSLKHQ RQKNDQIVLG DSFNNRSTGE  180
DMNHNHTLGS IGWKKWSRSG SFSSSKHVRS ESDGTLLDGS ALPGNETTIQ SMVSSPSLPN  240
EVKPMKKPRL GWGQGLAKYE KQKVGGSDDS CGRDDIVNGG SGATATHSDS SPKAGPVGSS  300
SPATPTSTTC NSSQRGLEEK LEFCVAKVDD ALIHEPQASP VVFSTKLENL NIDSITSLNS  360
LLTELLQPEE ACSGDTNNTR HTMSNKLQML KSDLLKELLK TDAEIDSSES ELKKISCNIF  420
SRPTQGDSIS PTTLEALDLQ QDVSPSTFKY TIKEFHSDNA VSVMLKSYNS DMPKQISTNC  480
GVVSVDENLV DVDCNGSEKL ENHSNLPIES CEIDQNSESL SCADLEKRLP VEVDCSHVVD  540
KIMDSNRISS GKAAEILSNH LPFRLPLHES KSTVKNVDSK IRGNLAIRKS YLKFKERALT  600
LKYRAFHLLW KEDLPSLSLM KRRSKSQKRC ELRCRSSQNG SESLRTSPRL QIPMPGKTSL  660
VPTKEIVGFT SSDLNIKIHR SFLKMPALIL DETDKRHSQF TTVNGLIDDP FLIEKEKALI  720
NPWTDEEKMV FLEMLGTYGK DFRKVSSFLH HKTTADCVGF YYKNHKSESF EHVRKILKFK  780
KKGQSLPSNN YMVAPGKPWK EDDVASLDIL GIASEIVSNS NDDKIRQKIT SRSVSGGVRD  840
MSISRRPYSR SSSAEFHAEA AADVLTGIGN SISSEGMSSC ITTSVDIGEK KDFLQLDHPF  900
SSEVISHTID EEDSSSDEDF RELASVDWTD TEKSMFVDAF RLFGMDFIQI SHYLETRSKE  960
QCKIFFSKTR KSLGLDTPMP LIDTAIPSND VNDGRSDTDD FCFAEMDSAI CSNNSSSKVD  1020
DFTQSVLKKS NQEFCRMANS CDQIDRNEWF KVRQSNNEEA DTKISCLTSR SINHNDKMVV  1080
ADQFNKLEKS ENIDGLIDVE IQKHNDVLTS QPLSATAEVI VKVKQNLGRE PQLASSQNSD  1140
ISLSCKSKPL GFLDSVLPYN EGRNGMSCTA RKNMPPIQPV SDAIKTTSKK ESSEQLQTKL  1200
MVFGMGKEYR LGLLLCQILL FFSLNILEDL KG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C9e-14680771494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D9e-14680771494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9P3U10.0A0A0K9P3U1_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-89MYB family protein